PDB entry 1i8x

View 1i8x on RCSB PDB site
Description: semi-automatic structure determination of the cg1 1-30 peptide based on aria
Class: cytokine
Keywords: Two beta-hairpin stack, CYTOKINE
Deposited on 2001-03-16, released 2002-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: granulin-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81013 (0-29)
      • engineered (16)
      • engineered (26)
    Domains in SCOPe 2.08: d1i8xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i8xA (A:)
    vihcdaaticpdgttcslspygvwycspfs