PDB entry 1i8o

View 1i8o on RCSB PDB site
Description: rhodopseudomonas palustris cyt c2 ammonia complex at 1.15 angstrom resolution
Deposited on 2001-03-15, released 2001-04-04
The last revision prior to the SCOP 1.63 freeze date was dated 2002-01-16, with a file datestamp of 2002-01-16.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.14
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1i8oa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i8oA (A:)
  edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
  dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk