PDB entry 1i89

View 1i89 on RCSB PDB site
Description: Chalcone synthase (G256L)
Class: transferase
Keywords: chalcone synthase, polyketide synthase, TRANSFERASE
Deposited on 2001-03-12, released 2001-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.215
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chalcone synthase 2
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30074 (Start-388)
      • engineered (255)
    Domains in SCOPe 2.07: d1i89a1, d1i89a2
  • Chain 'B':
    Compound: Chalcone synthase 2
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30074 (Start-388)
      • engineered (255)
    Domains in SCOPe 2.07: d1i89b1, d1i89b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i89A (A:)
    mvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmc
    dksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqp
    kskithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaen
    nkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemv
    wtaqtiapdsegaidlhlreagltfhllkdvpgivsknitkalveafeplgisdynsifw
    iahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglkt
    tgeglewgvlfgfgpgltietvvlrsvai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i89A (A:)
    vsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcd
    ksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpk
    skithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaenn
    kgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemvw
    taqtiapdsegaidlhlreagltfhllkdvpgivsknitkalveafeplgisdynsifwi
    ahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglktt
    geglewgvlfgfgpgltietvvlrsvai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i89B (B:)
    mvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmc
    dksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqp
    kskithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaen
    nkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemv
    wtaqtiapdsegaidlhlreagltfhllkdvpgivsknitkalveafeplgisdynsifw
    iahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglkt
    tgeglewgvlfgfgpgltietvvlrsvai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i89B (B:)
    vsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcd
    ksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpk
    skithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaenn
    kgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemvw
    taqtiapdsegaidlhlreagltfhllkdvpgivsknitkalveafeplgisdynsifwi
    ahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglktt
    geglewgvlfgfgpgltietvvlrsvai