PDB entry 1i88

View 1i88 on RCSB PDB site
Description: chalcone synthase (g256v)
Class: transferase
Keywords: chalcone synthase, polyketide synthase, TRANSFERASE
Deposited on 2001-03-12, released 2001-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.203
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chalcone synthase 2
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30074 (0-388)
      • modified residue (163)
      • engineered (255)
    Domains in SCOPe 2.07: d1i88a1, d1i88a2
  • Chain 'B':
    Compound: Chalcone synthase 2
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30074 (0-388)
      • modified residue (163)
      • engineered (255)
    Domains in SCOPe 2.07: d1i88b1, d1i88b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i88A (A:)
    mvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmc
    dksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqp
    kskithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaen
    nkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemv
    wtaqtiapdsegaidvhlreagltfhllkdvpgivsknitkalveafeplgisdynsifw
    iahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglkt
    tgeglewgvlfgfgpgltietvvlrsvai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i88B (B:)
    mvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmc
    dksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqp
    kskithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaen
    nkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekpifemv
    wtaqtiapdsegaidvhlreagltfhllkdvpgivsknitkalveafeplgisdynsifw
    iahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglkt
    tgeglewgvlfgfgpgltietvvlrsvai