PDB entry 1i7z

View 1i7z on RCSB PDB site
Description: antibody gnc92h2 bound to ligand
Class: immune system
Keywords: IgG fold, antibody, chimera, IMMUNE SYSTEM
Deposited on 2001-03-12, released 2001-08-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chimera of ig kappa chain: human constant region and mouse variable region
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i7za1, d1i7za2
  • Chain 'B':
    Compound: chimera of ig gamma-1 chain: human constant region and mouse variable region
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i7zb1, d1i7zb2
  • Chain 'C':
    Compound: chimera of ig kappa chain: human constant region and mouse variable region
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i7zc1, d1i7zc2
  • Chain 'D':
    Compound: chimera of ig gamma-1 chain: human constant region and mouse variable region
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i7zd1, d1i7zd2
  • Heterogens: COC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i7zA (A:)
    dlvltqspaslavslgqratiscrasksvstsgynymhwyqqkpgqppklliylasnlas
    gvparfsgsgsgtdftlnihpveeedaatyyclysrefppwtfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i7zB (B:)
    qvqlqqsgpelkkpgetvkiscktsgysftnygmnwvkqapgkglkwmgwintytgepty
    addfrgrfafslatsastaylqiinlknedtatyfcetydsplgdywgqgttvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i7zC (C:)
    dlvltqspaslavslgqratiscrasksvstsgynymhwyqqkpgqppklliylasnlas
    gvparfsgsgsgtdftlnihpveeedaatyyclysrefppwtfgggtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i7zD (D:)
    qvqlqqsgpelkkpgetvkiscktsgysftnygmnwvkqapgkglkwmgwintytgepty
    addfrgrfafslatsastaylqiinlknedtatyfcetydsplgdywgqgttvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc