PDB entry 1i7y

View 1i7y on RCSB PDB site
Description: crystal structure of c-phycocyanin of synechococcus vulcanus at 2.5 angstroms.
Deposited on 2001-03-11, released 2001-03-28
The last revision prior to the SCOP 1.67 freeze date was dated 2001-03-28, with a file datestamp of 2001-03-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    Domains in SCOP 1.67: d1i7yb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i7yB (B:)
    mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
    aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
    gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava