PDB entry 1i7o

View 1i7o on RCSB PDB site
Description: crystal structure of hpce
Class: isomerase, lyase
Keywords: bifunctional enzyme, isomerase, decarboxylase, LYASE
Deposited on 2001-03-10, released 2001-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i7oa1, d1i7oa2
  • Chain 'B':
    Compound: 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i7ob1, d1i7ob2
  • Chain 'C':
    Compound: 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i7oc1, d1i7oc2
  • Chain 'D':
    Compound: 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i7od1, d1i7od2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i7oA (A:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhasele
    fkppeeplvflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyva
    gytvcndyairdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelr
    qqgttadlifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvn
    rivseetak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i7oA (A:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhpeepl
    vflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyvagytvcndy
    airdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelrqqgttadl
    ifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvnrivseeta
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i7oB (B:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhasele
    fkppeeplvflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyva
    gytvcndyairdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelr
    qqgttadlifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvn
    rivseetak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i7oB (B:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhpeepl
    vflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyvagytvcndy
    airdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelrqqgttadl
    ifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvnrivseeta
    k
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i7oC (C:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhasele
    fkppeeplvflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyva
    gytvcndyairdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelr
    qqgttadlifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvn
    rivseetak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i7oC (C:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhpeepl
    vflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyvagytvcndy
    airdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelrqqgttadl
    ifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvnrivseeta
    k
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1i7oD (D:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhasele
    fkppeeplvflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyva
    gytvcndyairdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelr
    qqgttadlifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvn
    rivseetak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i7oD (D:)
    mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
    lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
    tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
    veiqpgdrvrvlaegfpplenpvvderevttrksfptlphphgtlfalglnyadhpeepl
    vflkapntltgdnqtsvrpnnieymhyeaelvvvigkqarnvseadamdyvagytvcndy
    airdylenyyrpnlrvksrdgltpmlstivpkeaipdphnltlrtfvngelrqqgttadl
    ifsvpfliaylsefmtlnpgdmiatgtpkglsdvvpgdevvvevegvgrlvnrivseeta
    k