PDB entry 1i73

View 1i73 on RCSB PDB site
Description: complex of pro-leu-l-trp phosphonate with the catalitic domain of matrix metallo proteinase-8 (met80 form)
Class: hydrolase
Keywords: Hydrolase, COMPLEX (METALLOPROTEASE/INHIBITOR)
Deposited on 2001-03-07, released 2001-03-21
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.138
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil collagenase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1i73a_
  • Chain 'B':
    Compound: three residue peptide inhibitor
    Species: synthetic, synthetic
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i73A (A:)
    mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
    iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
    ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg
    

  • Chain 'B':
    No sequence available.