PDB entry 1i6z

View 1i6z on RCSB PDB site
Description: bag domain of bag1 cochaperone
Class: chaperone
Keywords: triple helix bundle, CHAPERONE
Deposited on 2001-03-06, released 2001-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bag-family molecular chaperone regulator-1
  Species: Mus musculus [TaxId:10090]
  Gene: BAG1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60739 (5-134)
    • cloning artifact (0-4)
  Domains in SCOPe 2.08: d1i6za1, d1i6za2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i6zA (A:)
  gspefmligeksnpeeevelkklkdlevsaekianhlqelnkelsgiqqgflakelqaea
  lckldrkvkatieqfmkileeidtmvlpeqfkdsrlkrknlvkkvqvflaecdtveqyic
  qeterlqstnlalae