PDB entry 1i6f

View 1i6f on RCSB PDB site
Description: nmr solution structure of the insect-specific neurotoxin variant 5 (cse-v5) from the scorpion centruroides sculpturatus ewing
Class: toxin
Keywords: scorpion, neurotoxin, sodium channel, alpha helix, beta sheet, disulfide linkages
Deposited on 2001-03-02, released 2001-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neurotoxin v-5
  Species: Centruroides sculpturatus [TaxId:218467]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P58779 (0-58)
    • see remark 999 (59)
  Domains in SCOPe 2.08: d1i6fa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i6fA (A:)
  kdgypvdskgcklscvannycdnqckmkkasgghcyamscyceglpenakvsdsatnicg