PDB entry 1i6e

View 1i6e on RCSB PDB site
Description: solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the oxidized state
Class: electron transport
Keywords: electron transport, cytochrome c552, heme, redox states, isotope enrichment {13c/15n}, nmr spectroscopy, solution structure
Deposited on 2001-03-02, released 2001-10-17
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c552
    Species: Paracoccus denitrificans
    Gene: CYCM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54820 (1-99)
      • see remark 999 (0)
    Domains in SCOP 1.73: d1i6ea_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i6eA (A:)
    madpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpe
    alqefltnpkavvkgtkmafaglpkiedranliaylegqq