PDB entry 1i6d

View 1i6d on RCSB PDB site
Description: solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the reduced state
Deposited on 2001-03-02, released 2001-10-17
The last revision prior to the SCOP 1.71 freeze date was dated 2001-10-17, with a file datestamp of 2001-10-17.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1i6da_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i6dA (A:)
    madpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpe
    alqefltnpkavvkgtkmafaglpkiedranliaylegqq