PDB entry 1i5y

View 1i5y on RCSB PDB site
Description: hiv-1 gp41 core
Deposited on 2001-03-01, released 2002-09-10
The last revision prior to the SCOP 1.65 freeze date was dated 2002-09-10, with a file datestamp of 2002-09-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1i5ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1i5yA (A:)
sgivqqqnnllraieaqqhllqltvwaikqlqarsggrggwmewdreinnytslihslie
esqnqqek

    Sequence, based on observed residues (ATOM records): (download) 
    >1i5yA (A:)
ivqqqnnllraieaqqhllqltvwaikqlqarsggrggwmewdreinnytslihsliees
q