PDB entry 1i55
View 1i55 on RCSB PDB site
Description: cytochrome c (tuna) with 2zn:1fe mixed-metal porphyrins
Class: electron transport
Keywords: cytochrome c, electron transfer, zinc-porphyrin, ELECTRON TRANSPORT
Deposited on
2001-02-24, released
2001-05-09
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: cytochrome c
Species: Thunnus thynnus [TaxId:8237]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1i55a_ - Chain 'B':
Compound: cytochrome c
Species: Thunnus thynnus [TaxId:8237]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1i55b_ - Heterogens: HEM, ZNH, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1i55A (A:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1i55B (B:)
gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats