PDB entry 1i54

View 1i54 on RCSB PDB site
Description: cytochrome c (tuna) 2fe:1zn mixed-metal porphyrins
Deposited on 2001-02-24, released 2001-05-09
The last revision prior to the SCOP 1.65 freeze date was dated 2001-05-09, with a file datestamp of 2001-05-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.226
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1i54a_
  • Chain 'B':
    Domains in SCOP 1.65: d1i54b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i54A (A:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i54B (B:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats