PDB entry 1i4x

View 1i4x on RCSB PDB site
Description: staphylococcal enterotoxin c2, monoclinic form crystallized at ph 8.0
Class: toxin
Keywords: enterotoxin, superantigen, zinc binding
Deposited on 2001-02-23, released 2001-03-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.207
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterotoxin type c-2
    Species: Staphylococcus aureus [TaxId:1280]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i4xa1, d1i4xa2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i4xA (A:)
    esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
    nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4xA (A:)
    esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdntggktcmyggitkhegnhfd
    ngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetg
    yikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng