PDB entry 1i4x

View 1i4x on RCSB PDB site
Description: staphylococcal enterotoxin c2, monoclinic form crystallized at ph 8.0
Class: toxin
Keywords: enterotoxin, superantigen, zinc binding
Deposited on 2001-02-23, released 2001-03-14
The last revision prior to the SCOP 1.73 freeze date was dated 2001-09-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.207
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterotoxin type c-2
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1i4xa1, d1i4xa2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i4xA (A:)
    esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
    nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4xA (A:)
    esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdntggktcmyggitkhegnhfd
    ngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetg
    yikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng