PDB entry 1i4v
View 1i4v on RCSB PDB site
Description: solution structure of the umud' homodimer
Class: hydrolase
Keywords: SOS response, SOS mutagenesis, DNA repair, DNA polymerase V, DNA polymerase accessory protein, LexA repressor, lambda CI, signal peptidase, serine-lysine dyad, autocatalytic cleavage, serine protease, HYDROLASE
Deposited on
2001-02-23, released
2001-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: umud' protein
Species: Escherichia coli [TaxId:562]
Gene: UMUD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1i4va_ - Chain 'B':
Compound: umud' protein
Species: Escherichia coli [TaxId:562]
Gene: UMUD
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1i4vb_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1i4vA (A:)
afpspaadyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgd
iviaavdgeftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvkamr
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1i4vB (B:)
afpspaadyveqridlnqlliqhpsatyfvkasgdsmidggisdgdllivdsaitashgd
iviaavdgeftvkklqlrptvqlipmnsayspitissedtldvfgvvihvvkamr