PDB entry 1i4p

View 1i4p on RCSB PDB site
Description: crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.5
Deposited on 2001-02-22, released 2001-03-14
The last revision prior to the SCOP 1.59 freeze date was dated 2001-09-19, with a file datestamp of 2001-09-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i4pA (A:)
    esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
    nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4pA (A:)
    esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnggktcmyggitkhegnhfdn
    gnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy
    ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng