PDB entry 1i4j

View 1i4j on RCSB PDB site
Description: crystal structure of l22 ribosomal protein mutant
Class: RNA binding protein
Keywords: Ribosomal Protein, Mutant, Erythromycin Resistance, RNA binding, Crystal Structure, RNA BINDING PROTEIN
Deposited on 2001-02-22, released 2002-09-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.209
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 50S ribosomal protein L22
  Species: Thermus thermophilus [TaxId:274]
  Gene: RPL22
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48286 (0-109)
  Domains in SCOPe 2.03: d1i4ja_
• Chain 'B':
  Compound: 50S ribosomal protein L22
  Species: Thermus thermophilus [TaxId:274]
  Gene: RPL22
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48286 (0-109)
  Domains in SCOPe 2.03: d1i4jb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i4jA (A:)
  meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
  nhdaledrlyvkaayvdegpavlprargradiikkrtshitvilgekhgk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i4jB (B:)
  meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
  nhdaledrlyvkaayvdegpavlprargradiikkrtshitvilgekhgk