PDB entry 1i4h

View 1i4h on RCSB PDB site
Description: crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a
Deposited on 2001-02-21, released 2001-02-28
The last revision prior to the SCOP 1.65 freeze date was dated 2001-03-21, with a file datestamp of 2001-03-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.208
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i4hA (A:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
    hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
    rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4hA (A:)
    kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
    dfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlteekkvpinl
    wldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrglivfats
    tepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i4hB (B:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
    hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
    rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i4hB (B:)
    nekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndl
    lvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlteekkvpi
    nlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrglivfa
    tstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts