PDB entry 1i4g

View 1i4g on RCSB PDB site
Description: crystal structure of staphylococcal enterotoxin a mutant h187a with reduced zn2+ affinity
Deposited on 2001-02-21, released 2001-02-28
The last revision prior to the SCOP 1.61 freeze date was dated 2001-03-21, with a file datestamp of 2001-03-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i4gA (A:)
    kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
    dfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlteekkvpinl
    wldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrglivfats
    tepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i4gB (B:)
    nekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndl
    lvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlteekkvpi
    nlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrglivfa
    tstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts