PDB entry 1i3s

View 1i3s on RCSB PDB site
Description: the 2.7 angstrom resolution crystal structure of a mutated baculovirus p35 after caspase cleavage
Class: apoptosis
Keywords: hairpin loop, helix-turn-helix, reactive site loop, APOPTOSIS
Deposited on 2001-02-15, released 2001-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Early 35 kDa protein
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Gene: P35
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08160
      • conflict (36)
      • engineered (69)
    Domains in SCOPe 2.07: d1i3sa_
  • Chain 'B':
    Compound: Early 35 kDa protein
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Gene: P35
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08160 (Start-297)
      • conflict (36)
      • engineered (69)
    Domains in SCOPe 2.07: d1i3sb_
  • Chain 'C':
    Compound: Early 35 kDa protein
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Gene: P35
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08160 (Start-297)
      • conflict (36)
      • engineered (69)
    Domains in SCOPe 2.07: d1i3sc_
  • Heterogens: DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i3sA (A:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntmltkpvlmmfnisgpirsvtrknn
    nlrdrikskpdeqfdqlerdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks
    hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp
    faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm
    iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3sA (A:)
    sqtiirdcqvdkqtrelvyinkimntmltkpvlmmfnisgpirsvtrknnnlrdrikskp
    deqfdqlerdysdqmdsikyfkdehysvscqngsvlkskfakilkshdytdkksieayek
    yclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivpfaheindtglyeyd
    vvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksmiykalefttesswg
    ksekynwkifcngfiydkkskvlyvklhnvtsalnknvilnti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i3sB (B:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntmltkpvlmmfnisgpirsvtrknn
    nlrdrikskpdeqfdqlerdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks
    hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp
    faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm
    iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3sB (B:)
    sqtiirdcqvdkqtrelvyinkimntmltkpvlmmfnisgpirsvtrknnnlrdrikskp
    deqfdqlerdysdsikyfkdehysvscqngsvlkskfakilkshdytdkksieayekycl
    pklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivpfaheindtglyeydvva
    yvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksmiykalefttesswgkse
    kynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i3sC (C:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntmltkpvlmmfnisgpirsvtrknn
    nlrdrikskpdeqfdqlerdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks
    hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp
    faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm
    iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3sC (C:)
    sqtiirdcqvdkqtrelvyinkimntmltkpvlmmfnisgpirsvtrknnnlrdrikskp
    deqfdqlerdysdqsikyfkdehysvscqngsvlkskfakilkshdytdkksieayekyc
    lpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivpfaheindtglyeydvv
    ayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksmiykalefttesswgks
    ekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik