PDB entry 1i3r

View 1i3r on RCSB PDB site
Description: crystal structure of a mutant iek class ii mhc molecule
Deposited on 2001-02-15, released 2001-06-20
The last revision prior to the SCOP 1.67 freeze date was dated 2001-06-20, with a file datestamp of 2001-06-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i3rA (A:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rA (A:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i3rB (B:)
    rdsrgkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvry
    fynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnfl
    vprrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrn
    gdwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rB (B:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i3rC (C:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rC (C:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1i3rD (D:)
    rdsrgkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvry
    fynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnfl
    vprrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrn
    gdwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rD (D:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewka
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1i3rE (E:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rE (E:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1i3rF (F:)
    rdsrgkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvry
    fynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnfl
    vprrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrn
    gdwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rF (F:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewka
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1i3rG (G:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rG (G:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1i3rH (H:)
    rdsrgkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvry
    fynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnfl
    vprrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrn
    gdwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3rH (H:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewka