PDB entry 1i3r

View 1i3r on RCSB PDB site
Description:
Deposited on 2001-02-15, released 2001-06-20
The last revision prior to the SCOP 1.61 freeze date was dated 2001-06-20, with a file datestamp of 2001-06-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1i3ra1, d1i3ra2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1i3rb1, d1i3rb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1i3rc1, d1i3rc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1i3rd1, d1i3rd2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1i3re1, d1i3re2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1i3rf1, d1i3rf2
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1i3rg1, d1i3rg2
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1i3rh1, d1i3rh2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3rA (A:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3rB (B:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3rC (C:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3rD (D:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewka
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3rE (E:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3rF (F:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewka
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3rG (G:)
    ikeehtiiqaqfyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavnkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3rH (H:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewka