PDB entry 1i3p

View 1i3p on RCSB PDB site
Description: the 3.1 angstrom resolution crystal structure of a mutated baculovirus p35 after caspase cleavage
Class: apoptosis
Keywords: helix-turn-helix, reactive site loop, hairpin loop, APOPTOSIS
Deposited on 2001-02-15, released 2001-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Early 35 kDa protein
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Gene: P35
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08160
      • engineered (69)
    Domains in SCOPe 2.07: d1i3pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i3pA (A:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
    nlrdrikskpdeqfdqlekdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks
    hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp
    faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm
    iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3pA (A:)
    pveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknnnlrd
    rikskpdeqfdqlekdydsikyfkdehysvscqngsvlkskfakilkshdytdkksieay
    ekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivpfaheindtglye
    ydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneaksmiykalefttkynwki
    fcngfiydkkskvlyvklhnvtsalnknvilnti