PDB entry 1i3o

View 1i3o on RCSB PDB site
Description: crystal structure of the complex of xiap-bir2 and caspase 3
Deposited on 2001-02-15, released 2001-03-21
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-26, with a file datestamp of 2001-09-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.248
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1i3o.1
  • Chain 'B':
    Domains in SCOP 1.57: d1i3o.1
  • Chain 'C':
    Domains in SCOP 1.57: d1i3o.2
  • Chain 'D':
    Domains in SCOP 1.57: d1i3o.2
  • Chain 'E':
    Domains in SCOP 1.57: d1i3oe_
  • Chain 'F':
    Domains in SCOP 1.57: d1i3of_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3oA (A:)
    sldnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndl
    treeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsl
    tgkpklfiiqaargteldcgiet
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3oB (B:)
    sgvdddmachkipveadflyaystapgyyswrnskdgswfiqslcamlkqyadklefmhi
    ltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3oC (C:)
    sldnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndl
    treeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsl
    tgkpklfiiqaargteldcgietd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3oD (D:)
    sgvdddmachkipveadflyaystapgyyswrnskdgswfiqslcamlkqyadklefmhi
    ltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfy
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3oE (E:)
    faldrpsethadyllrtgqvvdisdtiyprnpamyseearlksfqnwpdyahltprelas
    aglyytgigdqvqcfacggklknwepgdrawsehrrhfpncffvlgrnlni
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1i3oF (F:)
    thadyllrtgqvvdisdtiyprnpamyseearlksfqnwpdyahltprelasaglyytgi
    gdqvqcfacggklknwepgdrawsehrrhfpncffvlgrnln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3oF (F:)
    thadyllrtgqvvdisdtiyprnpamyseearlksltprelasaglyytgigdqvqcfac
    ggklknwepgdrawsehrrhfpncffvlgrnln