PDB entry 1i3g

View 1i3g on RCSB PDB site
Description: crystal structure of an ampicillin single chain fv, form 1, free
Class: antibiotic
Keywords: ANTIBODY FV FRAGMENT, antibiotic
Deposited on 2001-02-15, released 2001-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.175
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody fv fragment
    Species: Mus musculus, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1I3G (0-End)
    Domains in SCOPe 2.06: d1i3gh_
  • Chain 'L':
    Compound: antibody fv fragment
    Species: Mus musculus, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1I3G
    Domains in SCOPe 2.06: d1i3gl_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1i3gH (H:)
    qvqlqqpgaelvrpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytny
    nqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvtvsaasgahhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3gH (H:)
    qvqlqqpgaelvrpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytny
    nqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvtvs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1i3gL (L:)
    dykdivltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtg
    vpdrftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i3gL (L:)
    divltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvpd
    rftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklel