PDB entry 1i3g

View 1i3g on RCSB PDB site
Description: crystal structure of an ampicillin single chain fv, form 1, free
Deposited on 2001-02-15, released 2001-10-17
The last revision prior to the SCOP 1.63 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.175
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.63: d1i3gh_
  • Chain 'L':
    Domains in SCOP 1.63: d1i3gl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3gH (H:)
    qvqlqqpgaelvrpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytny
    nqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvtvs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i3gL (L:)
    divltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvpd
    rftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklel