PDB entry 1i3e

View 1i3e on RCSB PDB site
Description: human azido-met hemoglobin bart's (gamma4)
Class: oxygen storage/transport
Keywords: oxygen transport, oxygen storage-transport complex
Deposited on 2001-02-15, released 2001-09-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.184
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin gamma chains
    Species: Homo sapiens [TaxId:9606]
    Gene: HBG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1i3ea_
  • Chain 'B':
    Compound: hemoglobin gamma chains
    Species: Homo sapiens [TaxId:9606]
    Gene: HBG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1i3eb_
  • Heterogens: AZI, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i3eA (A:)
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i3eB (B:)
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh