PDB entry 1i3d

View 1i3d on RCSB PDB site
Description: human carbonmonoxy hemoglobin bart's (gamma4)
Class: oxygen storage/transport
Keywords: oxygen transport, oxygen storage/transport complex
Deposited on 2001-02-15, released 2001-09-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.211
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin gamma chains
    Species: Homo sapiens [TaxId:9606]
    Gene: HBG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i3da_
  • Chain 'B':
    Compound: hemoglobin gamma chains
    Species: Homo sapiens [TaxId:9606]
    Gene: HBG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1i3db_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i3dA (A:)
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i3dB (B:)
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtavasalssryh