PDB entry 1i2d

View 1i2d on RCSB PDB site
Description: crystal structure of atp sulfurylase from penicillium chrysogenum
Deposited on 2001-02-07, released 2001-07-11
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-11, with a file datestamp of 2001-07-11.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.207
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i2dA (A:)
    anaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmnq
    adydrvcednrladgnvfsmpitldasqevidekklqagsritlrdfrddrnlailtidd
    iyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhydyvalrytpael
    rvhfdklgwsrvvafqtrnpmhrahreltvraarsrqanvlihpvvgltkpgdidhftrv
    rayqallprypngmavlgllglamrmggpreaiwhaiirknhgathfivgrdhagpgsns
    kgedfygpydaqhavekykdelgievvefqmvtylpdtdeyrpvdqvpagvktlnisgte
    lrrrlrsgahipewfsypevvkilresnppratqgftifltgymnsgkdaiaralqvtln
    qqggrsvslllgdtvrhelsselgftredrhtniqriafvateltragaaviaapiapye
    esrkfardavsqagsfflvhvatplehceqsdkrgiyaaarrgeikgftgvddpyetpek
    adlvvdfskqsvrsivheiilvlesqgflerq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i2dB (B:)
    anaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmnq
    adydrvcednrladgnvfsmpitldasqevidekklqagsritlrdfrddrnlailtidd
    iyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhydyvalrytpael
    rvhfdklgwsrvvafqtrnpmhrahreltvraarsrqanvlihpvvgltkpgdidhftrv
    rayqallprypngmavlgllglamrmggpreaiwhaiirknhgathfivgrdhagpgsns
    kgedfygpydaqhavekykdelgievvefqmvtylpdtdeyrpvdqvpagvktlnisgte
    lrrrlrsgahipewfsypevvkilresnppratqgftifltgymnsgkdaiaralqvtln
    qqggrsvslllgdtvrhelsselgftredrhtniqriafvateltragaaviaapiapye
    esrkfardavsqagsfflvhvatplehceqsdkrgiyaaarrgeikgftgvddpyetpek
    adlvvdfskqsvrsivheiilvlesqgflerq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i2dC (C:)
    anaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmnq
    adydrvcednrladgnvfsmpitldasqevidekklqagsritlrdfrddrnlailtidd
    iyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhydyvalrytpael
    rvhfdklgwsrvvafqtrnpmhrahreltvraarsrqanvlihpvvgltkpgdidhftrv
    rayqallprypngmavlgllglamrmggpreaiwhaiirknhgathfivgrdhagpgsns
    kgedfygpydaqhavekykdelgievvefqmvtylpdtdeyrpvdqvpagvktlnisgte
    lrrrlrsgahipewfsypevvkilresnppratqgftifltgymnsgkdaiaralqvtln
    qqggrsvslllgdtvrhelsselgftredrhtniqriafvateltragaaviaapiapye
    esrkfardavsqagsfflvhvatplehceqsdkrgiyaaarrgeikgftgvddpyetpek
    adlvvdfskqsvrsivheiilvlesqgflerq