PDB entry 1i29

View 1i29 on RCSB PDB site
Description: crystal structure of csdb complexed with l-propargylglycine
Class: lyase
Keywords: External aldimine, LYASE
Deposited on 2001-02-07, released 2003-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: csdb
    Species: Escherichia coli [TaxId:562]
    Gene: CSDB OR SUFS
    Database cross-references and differences (RAF-indexed):
    • GB BAB21542 (Start-405)
    Domains in SCOPe 2.07: d1i29a_
  • Heterogens: LPG, PLP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i29A (A:)
    mifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgiht
    lsaqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisq
    mehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgte
    nplaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvke
    allqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalgln
    niaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrt
    ghhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i29A (A:)
    ifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtl
    saqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqm
    ehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgten
    plaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkea
    llqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnn
    iaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtg
    hhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg