PDB entry 1i27

View 1i27 on RCSB PDB site
Description: crystal structure of the c-terminal domain of the rap74 subunit of human transcription factor iif (tfiif)
Class: transcription
Keywords: general transcription factor, rap74, rap30, tfiif, RNA polymerase II, winged-helix domain
Deposited on 2001-02-07, released 2001-03-07
The last revision prior to the SCOP 1.73 freeze date was dated 2001-03-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: 0.127
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription factor iif
  Species: HOMO SAPIENS
  Gene: RAP74
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35269 (4-72)
    • cloning artifact (0-3)
  Domains in SCOP 1.73: d1i27a_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i27A (A:)
  gplgsgdvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnper
  kmindkmhfslke