PDB entry 1i27

View 1i27 on RCSB PDB site
Description: crystal structure of the c-terminal domain of the rap74 subunit of human transcription factor iif (tfiif)
Deposited on 2001-02-07, released 2001-03-07
The last revision prior to the SCOP 1.69 freeze date was dated 2001-03-07, with a file datestamp of 2001-03-07.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: 0.127
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1i27a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i27A (A:)
  gplgsgdvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnper
  kmindkmhfslke