PDB entry 1i1i

View 1i1i on RCSB PDB site
Description: neurolysin (endopeptidase 24.16) crystal structure
Class: hydrolase
Keywords: neuropeptidase, zinc metallopeptidase, endopeptidase, HYDROLASE
Deposited on 2001-02-01, released 2001-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: Neurolysin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i1ip_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1i1iP (P:)
    mtlgkelasplqamssytaagrnvlrwdlspeqiktrteqliaqtkqvydtvgtialkev
    tyenclqvladievtyivertmldfpqhvssdrevraasteadkklsrfdiemsmredvf
    qrivhlqetcdlekikpearryleksikmgkrnglhlsehirneiksmkkrmselcidfn
    knlneddtslvfskaelgalpddfidslektdedkykvtlkyphyfpvmkkccvpetrrk
    memafhtrckqentailqqllplraqvakllgynthadfvlelntakstsrvaaflddls
    qklkplgeaerefilslkkkeceergfeydgkinawdlhyymtqteelkysvdqeslkey
    fpievvtegllsiyqellglsfeqvpdahvwnksvslytvkdkatgevlgqfyldlypre
    gkynhaacfglqpgcllpdgsrmmsvaalvvnfsqpvagrpsllrhdevrtyfhefghvm
    hqicaqtdfarfsgtnvetdfvevpsqmlenwvwdvdslrklskhykdghpitdellekl
    vasrlvntglltlrqivlskvdqslhtnatldaaseyakycteilgvaatpgtnmpatfg
    hlaggydgqyygylwsevfsmdmfhscfkkegimnpevgmkyrnlilkpggsldgmdmlq
    nflqrepnqkaflmsrglngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1iP (P:)
    mssytaagrnvlrwdlspeqiktrteqliaqtkqvydtvgtialkevtyenclqvladie
    vtyivertmldfpqhvssdrevraasteadkklsrfdiemsmredvfqrivhlqetcdle
    kikpearryleksikmgkrnglhlsehirneiksmkkrmselcidfnknlneddtslvfs
    kaelgalpddfidslektdedkykvtlkyphyfpvmkkccvpetrrkmemafhtrckqen
    tailqqllplraqvakllgynthadfvlelntakstsrvaaflddlsqklkplgeaeref
    ilslkkkeceergfeydgkinawdlhyymtqteelkysvdqeslkeyfpievvtegllsi
    yqellglsfeqvpdahvwnksvslytvkdkatgevlgqfyldlypregkynhaacfglqp
    gcllpdgsrmmsvaalvvnfsqpvagrpsllrhdevrtyfhefghvmhqicaqtdfarfs
    gtnvetdfvevpsqmlenwvwdvdslrklskhykdghpitdelleklvasrlvntglltl
    rqivlskvdqslhtnatldaaseyakycteilgvaatpgtnmpatfghlaggydgqyygy
    lwsevfsmdmfhscfkkegimnpevgmkyrnlilkpggsldgmdmlqnflqrepnqkafl
    msrgl