PDB entry 1i1c

View 1i1c on RCSB PDB site
Description: non-fcrn binding fc fragment of rat igg2a
Deposited on 2001-01-31, released 2001-02-14
The last revision prior to the SCOP 1.65 freeze date was dated 2001-05-09, with a file datestamp of 2001-05-09.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.241
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i1cA (A:)
    vprecnpcgctgsevssvfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddv
    evhtaqthapekqsnstlrsvselpiverdwlngktfkckvnsgafpapieksiskpegt
    prgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtdg
    syflysklnvkketwqqgntftcsvlheglenehtekslshspgkgiegrgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1cA (A:)
    svfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
    tlrsvselpiverdwlngktfkckvnsgafpapieksiskpegtprgpqvytmappkeem
    tqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtdgsyflysklnvkketwq
    qgntftcsvlheglenehtekslsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i1cB (B:)
    vprecnpcgctgsevssvfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddv
    evhtaqthapekqsnstlrsvselpiverdwlngktfkckvnsgafpapieksiskpegt
    prgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtdg
    syflysklnvkketwqqgntftcsvlheglenehtekslshspgkgiegrgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1cB (B:)
    svfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
    tlrsvselpiverdwlngktfkckvnsgafpapieksiskpegtprgpqvytmappkeem
    tqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtdgsyflysklnvkketwq
    qgntftcsvlheglenehtekslsh