PDB entry 1i1a

View 1i1a on RCSB PDB site
Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc
Class: immune system
Keywords: MHC class I fold, Ig constant domains, IMMUNE SYSTEM
Deposited on 2001-01-31, released 2001-02-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neonatal fc receptor a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1i1aa1, d1i1aa2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1i1ab_
  • Chain 'C':
    Compound: ig gamma-2a chain c region
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1i1ac1, d1i1ac2
  • Chain 'D':
    Compound: ig gamma-2a chain c region
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20760
      • engineered (29-31)
      • engineered (87)
      • engineered (210)
      • engineered (212)
    Domains in SCOPe 2.01: d1i1ad1, d1i1ad2
  • Heterogens: NDG, NAG, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i1aA (A:)
    aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
    wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
    rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlewke
    ppsmrlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfhaws
    llevkrgdehhyqcqveheglaqpltvdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1aA (A:)
    lplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswyweke
    ttdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefmrfnp
    rtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlewkeppsm
    rlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfhawsllev
    krgdehhyqcqveheglaqpltvdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i1aB (B:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i1aC (C:)
    vprecnpcgctgsevssvfifppktkdvltitltpkvtcvvvdisqndpevrfswfiddv
    evhtaqthapekqsnstlrsvselpivhrdwlngktfkckvnsgafpapieksiskpegt
    prgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtdg
    syflysklnvkketwqqgntftcsvlheglhnhhtekslshspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1aC (C:)
    svfifppktkdvltitltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
    tlrsvselpivhrdwlngktfkckvnsgafpapieksiskpegtprgpqvytmappkeem
    tqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtdgsyflysklnvkketwq
    qgntftcsvlheglhnhhtekslsh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1i1aD (D:)
    vprecnpcgctgsevssvfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddv
    evhtaqthapekqsnstlrsvselpiverdwlngktfkckvnsgafpapieksiskpegt
    prgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtdg
    syflysklnvkketwqqgntftcsvlheglenehtekslshspgkgiegrgsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i1aD (D:)
    svfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
    tlrsvselpiverdwlngktfkckvnsgafpapieksiskpegtprgpqvytmappkeem
    tqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtdgsyflysklnvkketwq
    qgntftcsvlheglenehtekslsh