PDB entry 1i1a

View 1i1a on RCSB PDB site
Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc
Deposited on 2001-01-31, released 2001-02-14
The last revision prior to the SCOP 1.59 freeze date was dated 2001-05-09, with a file datestamp of 2001-05-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i1aA (A:)
    lplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswyweke
    ttdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefmrfnp
    rtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlewkeppsm
    rlkarpgnsgssvltcaafsfyppelkfrflrnglasgsgncstgpngdgsfhawsllev
    krgdehhyqcqveheglaqpltvdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i1aB (B:)
    iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
    sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i1aC (C:)
    svfifppktkdvltitltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
    tlrsvselpivhrdwlngktfkckvnsgafpapieksiskpegtprgpqvytmappkeem
    tqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtdgsyflysklnvkketwq
    qgntftcsvlheglhnhhtekslsh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i1aD (D:)
    svfifppktkdvlgggltpkvtcvvvdisqndpevrfswfiddvevhtaqthapekqsns
    tlrsvselpiverdwlngktfkckvnsgafpapieksiskpegtprgpqvytmappkeem
    tqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtdgsyflysklnvkketwq
    qgntftcsvlheglenehtekslsh