PDB entry 1i0u

View 1i0u on RCSB PDB site
Description: solution structure and backbone dynamics of a concatemer of egf-homology modules of the human low density lipoprotein receptor
Class: lipid binding protein
Keywords: anti-parallel beta strands, calcium binding sites, LIPID BINDING PROTEIN
Deposited on 2001-01-29, released 2001-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: low density lipoprotein receptor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01130 (0-81)
  Domains in SCOPe 2.06: d1i0ua1, d1i0ua2
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i0uA (A:)
  gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtcsqlcvnleg
  gykcqceegfqldphtkackav