PDB entry 1i09

View 1i09 on RCSB PDB site
Description: structure of glycogen synthase kinase-3 (gsk3b)
Class: transferase
Keywords: kinase, beta barrel, TRANSFERASE
Deposited on 2001-01-29, released 2002-01-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.242
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49841
      • see remark 999 (349)
    Domains in SCOPe 2.03: d1i09a_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49841
      • see remark 999 (349)
    Domains in SCOPe 2.03: d1i09b_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i09A (A:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i09A (A:)
    smkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvai
    kkvlqdkrfknrelqimrkldhcnivrlryffyssylnlvldyvpetvyrvarhysrakq
    tlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrge
    pnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiik
    vlgtptreqiremnwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdp
    nvklpngrdtpalfnfttqelssnpplatilipphari
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i09B (B:)
    msgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytdtk
    vigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffyssg
    ekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgichr
    dikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssidv
    wsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqikahp
    wtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpalf
    nfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasnst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i09B (B:)
    vttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknr
    elqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpvi
    yvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsy
    icsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtp
    treqiremnfkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffd
    elrdpnvklpngrdtpalfnfttqelssnpplatilippha