PDB entry 1i09

View 1i09 on RCSB PDB site
Description: structure of glycogen synthase kinase-3 (gsk3b)
Deposited on 2001-01-29, released 2002-01-01
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-01, with a file datestamp of 2002-01-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.242
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1i09a_
  • Chain 'B':
    Domains in SCOP 1.59: d1i09b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i09A (A:)
    smkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvai
    kkvlqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvar
    hysrakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsa
    kqlvrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvd
    qlveiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleyt
    ptarltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i09A (A:)
    smkvsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvai
    kkvlqdkrfknrelqimrkldhcnivrlryffyssylnlvldyvpetvyrvarhysrakq
    tlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrge
    pnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiik
    vlgtptreqiremnwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdp
    nvklpngrdtpalfnfttqelssnpplatilipphari
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i09B (B:)
    vttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknr
    elqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpvi
    yvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsy
    icsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtp
    treqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleaca
    hsffdelrdpnvklpngrdtpalfnfttqelssnpplatilippha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i09B (B:)
    vttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknr
    elqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpvi
    yvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsy
    icsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtp
    treqiremnfkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffd
    elrdpnvklpngrdtpalfnfttqelssnpplatilippha