PDB entry 1hzh

View 1hzh on RCSB PDB site
Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design
Class: immune system
Keywords: immunoglobulin, antibody, b12, IMMUNE SYSTEM
Deposited on 2001-01-24, released 2001-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAA52919 (3-131)
      • see remark 999 (0-2)
      • see remark 999 (4)
    • GB AAA02914 (132-456)
    Domains in SCOPe 2.06: d1hzhh1, d1hzhh2, d1hzhh3, d1hzhh4
  • Chain 'K':
    Compound: immunoglobulin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAA52919 (3-131)
      • see remark 999 (0-2)
      • see remark 999 (4)
    • GB AAA02914 (132-End)
    Domains in SCOPe 2.06: d1hzhk1, d1hzhk2, d1hzhk3, d1hzhk4
  • Chain 'L':
    Compound: immunoglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAA52920 (0-108)
      • see remark 999 (1-2)
      • see remark 999 (6)
      • see remark 999 (34)
    • GB AAC02819 (109-214)
    Domains in SCOPe 2.06: d1hzhl1, d1hzhl2
  • Chain 'M':
    Compound: immunoglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAA52920 (0-108)
      • see remark 999 (1-2)
      • see remark 999 (6)
      • see remark 999 (34)
    • GB AAC02819 (109-214)
    Domains in SCOPe 2.06: d1hzhm1, d1hzhm2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzhH (H:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdkthtcppcp
    apellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktk
    preeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvyt
    lppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskl
    tvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1hzhK (K:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdkthtcppcp
    apellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktk
    preeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvyt
    lppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskl
    tvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hzhK (K:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdkcppcpapellggpsv
    flfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynsty
    rvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrdeltk
    nqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqg
    nvfscsvmhealhnhytqkslsls
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzhL (L:)
    eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
    drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hzhM (M:)
    eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
    drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec