PDB entry 1hz5

View 1hz5 on RCSB PDB site
Description: crystal structures of the b1 domain of protein l from peptostreptococcus magnus, with a tyrosine to tryptophan substitution
Class: protein binding
Keywords: Four stranded beta-sheet with central alpha helix, binds kappa light chain of immunoglobulins, zinc coordinated Histag, PROTEIN BINDING
Deposited on 2001-01-23, released 2001-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (9-71)
      • expression tag (0-7)
      • cloning artifact (8)
      • engineered (54)
    Domains in SCOPe 2.08: d1hz5a1, d1hz5a2
  • Chain 'B':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51912 (9-71)
      • expression tag (0-7)
      • cloning artifact (8)
      • engineered (54)
    Domains in SCOPe 2.08: d1hz5b1, d1hz5b2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hz5A (A:)
    mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
    dkgytlnikfag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hz5B (B:)
    mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
    dkgytlnikfag