PDB entry 1hz4

View 1hz4 on RCSB PDB site
Description: crystal structure of transcription factor malt domain iii
Deposited on 2001-01-23, released 2001-11-28
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-28, with a file datestamp of 2001-11-28.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.189
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1hz4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hz4A (A:)
    eikdiredtmhaefnalraqvaindgnpdeaerlaklaleelppgwfysrivatsvlgev
    lhckgeltrslalmqqteqmarqhdvwhyalwsliqqseilfaqgflqtawetqekafql
    ineqhleqlpmheflvriraqllwawarldeaeasarsgievlssyqpqqqlqclamliq
    cslargdldnarsqlnrlenllgngkyhsdwisnankvrviywqmtgdkaaaanwlrhta
    kpefannhflqgqwrniaraqillgefepaeivleelnenarslrlmsdlnrnllllnql
    ywqagrksdaqrvlldalklanrtgfishfviegeamaqqlrqliqlntlpeleqhraqr
    ilrein