PDB entry 1hyy

View 1hyy on RCSB PDB site
Description: crystal form II: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog
Class: catalytic antibody
Keywords: catalytic antibody, ester hydrolysis, esterolytic, fab, immunoglobulin
Deposited on 1997-06-08, released 1997-12-10
The last revision prior to the SCOPe 2.06 freeze date was dated 1997-12-10, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.228
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin 6d9
    Species: MUS MUSCULUS
  • Chain 'L':
    Compound: immunoglobulin 6d9
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PIR S52028 (2-215)
      • conflict (6)
      • conflict (26)
      • conflict (34)
      • conflict (38)
      • conflict (40)
      • conflict (107)
    Domains in SCOPe 2.06: d1hyyl3, d1hyyl4
  • Heterogens: CPD, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hyyL (L:)
    elvmtqtplslpvslgdqasiscrssqtivhsngdtyldwflqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr