PDB entry 1hyy

View 1hyy on RCSB PDB site
Description: crystal form ii: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog
Deposited on 1997-06-08, released 1997-12-10
The last revision prior to the SCOP 1.63 freeze date was dated 1997-12-10, with a file datestamp of 1997-12-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.228
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hyyH (H:)
    evkllesggglvkpggslklscaasgftfsnyamswvrqtpekrlewvvsissggsiyyl
    dsvkgrftvsrdnarnilylqmtslrsedtamyfcarvshydgsrdwyfdvwgagtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hyyL (L:)
    elvmtqtplslpvslgdqasiscrssqtivhsngdtyldwflqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr