PDB entry 1hys

View 1hys on RCSB PDB site
Description: crystal structure of hiv-1 reverse transcriptase in complex with a polypurine tract RNA:DNA
Class: transferase/DNA-RNA hybrid
Keywords: polypurine tract, PPT, protein-nucleic acid complex, RNase H, RNA:DNA, unpaired base, RNase H primer grip, TRANSFERASE/DNA/RNA COMPLEX, TRANSFERASE/DNA-RNA HYBRID COMPLEX
Deposited on 2001-01-22, released 2001-03-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.274
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 reverse transcriptase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-552)
      • engineered (279)
    Domains in SCOPe 2.01: d1hysa1, d1hysa2
  • Chain 'B':
    Compound: hiv-1 reverse transcriptase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-424)
      • engineered (279)
    Domains in SCOPe 2.01: d1hysb_
  • Chain 'C':
    Compound: fab-28 monoclonal antibody fragment light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1HYS (0-213)
    Domains in SCOPe 2.01: d1hysc1, d1hysc2
  • Chain 'D':
    Compound: fab-28 monoclonal antibody fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1HYS (0-219)
    Domains in SCOPe 2.01: d1hysd1, d1hysd2
  • Chain 'E':
    Compound: 5'-r(*up*cp*ap*gp*cp*cp*ap*cp*up*up*up*up*up*ap*ap*ap*ap*gp*ap*ap*ap*ap*g)-3'
    Species:
    Gene:
  • Chain 'F':
    Compound: 5'-d(*cp*tp*tp*tp*tp*cp*tp*tp*tp*tp*ap*ap*ap*ap*ap*gp*tp*gp*gp*cp*tp*g)-3'
    Species:
    Gene:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hysA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hysB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hysC (C:)
    diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
    afsgsgsgtdysltisnlepedfatyycqqyskfpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvawaidgsaaangvlnswtdqdskdstysmsstlt
    ltadayeaansytcaathktstspivksfnanec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hysD (D:)
    qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
    ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
    vssaattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.