PDB entry 1hyr

View 1hyr on RCSB PDB site
Description: crystal structure of human mica in complex with natural killer cell receptor nkg2d
Class: immune system
Keywords: activating nk cell receptor, nkg2d, c-type-lectin like, mic-a, MHC-I, complex, immune system
Deposited on 2001-01-21, released 2001-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.227
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nkg2-d type II integral membrane protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NKG2D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hyra_
  • Chain 'B':
    Compound: nkg2-d type II integral membrane protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NKG2D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hyrb_
  • Chain 'C':
    Compound: MHC class I chain-related protein a
    Species: Homo sapiens [TaxId:9606]
    Gene: MICA-001
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9TQ92 (1-274)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d1hyrc1, d1hyrc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hyrA (A:)
    nslfnqevqipltesycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvys
    kedqdllklvksyhwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgy
    iencstpntyicmqrtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hyrA (A:)
    esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
    hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
    qrtv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hyrB (B:)
    nslfnqevqipltesycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvys
    kedqdllklvksyhwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgy
    iencstpntyicmqrtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hyrB (B:)
    ipltesycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllkl
    vksyhwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpnt
    yicmqrtv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hyrC (C:)
    mephslrynltvlswdgsvqsgfltevhldgqpflrcdrqkcrakpqgqwaedvlgnktw
    dretrdltgngkdlrmtlahikdqkeglhslqeirvceihednstrssqhfyydgelfls
    qnletkewtmpqssraqtlamnvrnflkedamktkthyhamhadclqelrrylksgvvlr
    rtvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgng
    tyqtwvatricqgeeqrftcymehsgnhsthpvps