PDB entry 1hyr

View 1hyr on RCSB PDB site
Description: crystal structure of human mica in complex with natural killer cell receptor nkg2d
Deposited on 2001-01-21, released 2001-05-23
The last revision prior to the SCOP 1.59 freeze date was dated 2001-05-23, with a file datestamp of 2001-05-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.227
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hyrA (A:)
    esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
    hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
    qrtv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hyrB (B:)
    ipltesycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllkl
    vksyhwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpnt
    yicmqrtv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hyrC (C:)
    mephslrynltvlswdgsvqsgfltevhldgqpflrcdrqkcrakpqgqwaedvlgnktw
    dretrdltgngkdlrmtlahikdqkeglhslqeirvceihednstrssqhfyydgelfls
    qnletkewtmpqssraqtlamnvrnflkedamktkthyhamhadclqelrrylksgvvlr
    rtvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgng
    tyqtwvatricqgeeqrftcymehsgnhsthpvps